"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G1QPI3"	"{'domain_architectures': 314, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 2, 'ssf': 2, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 314}"	"['Acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria. Required for incorporation of iron-sulfur clusters into SDHB, the iron-sulfur protein subunit of succinate dehydrogenase that is involved in complex II of the mitochondrial electron transport chain. Recruited to SDHB by interaction with SDHAF1 which first binds SDHB and then recruits the iron-sulfur transfer complex formed by HSC20, HSPA9 and ISCU through direct binding to HSC20. Plays an essential role in hematopoiesis', 'Acts as a co-chaperone in iron-sulfur cluster assembly in the cytoplasm. Also mediates complex formation between components of the cytosolic iron-sulfur biogenesis pathway and the CIA targeting complex composed of CIAO1, DIPK1B/FAM69B and MMS19 by binding directly to the scaffold protein ISCU and to CIAO1. This facilitates iron-sulfur cluster insertion into a number of cytoplasmic and nuclear proteins including POLD1, ELP3, DPYD and PPAT']"	"HSCB"	"[{'identifier': 'GO:0051259', 'name': 'protein complex oligomerization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0001671', 'name': 'ATPase activator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051087', 'name': 'protein-folding chaperone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0044571', 'name': '[2Fe-2S] cluster assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G1QPI3_NOMLE"	"590f77cafbeb0bcf335726e1b1d014e3c6cf101d"	True	False	False	235	"Iron-sulfur cluster co-chaperone protein HscB"	3	"UP000001073"	"MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPRREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGVEIPEGTDYEMDRQFLMEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL"	"unreviewed"	"{'taxId': '61853', 'scientificName': 'Nomascus leucogenys', 'fullName': 'Nomascus leucogenys (Northern white-cheeked gibbon)'}"
