"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G1NNY7"	"{'domain_architectures': 9584, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9584}"	"['Component of the commander complex that is essential for endosomal recycling of transmembrane cargos; the commander complex is composed of the CCC subcomplex and the retriever subcomplex. Component of the retriever complex, which is a heterotrimeric complex related to retromer cargo-selective complex (CSC) and essential for retromer-independent retrieval and recycling of numerous cargos such as integrin alpha-5/beta-1 (ITGA5:ITGB1). The recruitment of the retriever complex to the endosomal membrane involves CCC and WASH complexes. In the endosomes, drives the retriever and recycling of NxxY-motif-containing cargo proteins by coupling to SNX17, a cargo essential for the homeostatic maintenance of numerous cell surface proteins associated with processes that include cell migration, cell adhesion, nutrient supply and cell signaling']"	"VPS26C"	"[{'identifier': 'GO:0006886', 'name': 'intracellular protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G1NNY7_MELGA"	"48a17636f5b7a8739160239fa50118fb5e352930"	True	False	False	297	"Vacuolar protein sorting-associated protein 26C"	3	"UP000001645"	"MGTALDIKIKRANKVYHCGEILSGVVVITSKDTVQHQGISLTMEGSVNLQLSAKSVGVFEAFYNSVKPIQIINSTIEMVKPGKLPSGKTEIPFEFPLHVKGNKVLYETYHGVFVNIQYTLRCDMRRSLLAKDLTKTCEFIVHSVSQKGKLTPSPVDFTITPETLQNVKERASLPKFLIRGHLSSTNCIITQPLTGELVVESAEAAVKSIELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLPIPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHDDHLITENFPLKLCRM"	"unreviewed"	"{'taxId': '9103', 'scientificName': 'Meleagris gallopavo', 'fullName': 'Meleagris gallopavo (Wild turkey)'}"