"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G1LAI8"	"{'domain_architectures': 7990, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7990}"	"['Bri23 peptide prevents aggregation of APP amyloid-beta protein 42 into toxic oligomers', 'Mature BRI2 (mBRI2) functions as a modulator of the amyloid-beta A4 precursor protein (APP) processing leading to a strong reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42', 'Plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. Plays a role in the induction of neurite outgrowth. Functions as a protease inhibitor by blocking access of secretases to APP cleavage sites']"	"ITM2B"	""	"G1LAI8_AILME"	"883524b6fbdaf50d6c9f78577c11053e90ab5e79"	True	False	False	266	"Integral membrane protein 2"	3	"UP000008912"	"MVKVTFNSALAQKETKKDEPKCGEEALIIPPDAVAVDCKDPDEVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDHLGFFIYRLCHDKETYKLQRRETIRGIQKREVSNCVTIRHFENKFAVETVICP"	"unreviewed"	"{'taxId': '9646', 'scientificName': 'Ailuropoda melanoleuca', 'fullName': 'Ailuropoda melanoleuca (Giant panda)'}"