"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G1KVI7"	"{'domain_architectures': 481, 'entries': 28, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 3, 'ssf': 3, 'smart': 3, 'profile': 3, 'cdd': 1, 'pfam': 3, 'panther': 1, 'prints': 2, 'interpro': 9}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 481}"	"['Subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction. Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane. This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox']"	"NCF4"	"[{'identifier': 'GO:0035091', 'name': 'phosphatidylinositol binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016176', 'name': 'superoxide-generating NADPH oxidase activator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006909', 'name': 'phagocytosis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045730', 'name': 'respiratory burst', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0043020', 'name': 'NADPH oxidase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"G1KVI7_ANOCA"	"55c051f146d7e0bc881a8c55dd9289d76d97af70"	True	False	False	350	"Neutrophil cytosol factor 4"	4	"UP000001646"	"MSLPRQLRGESDFDQLPDDVAVSANIADIEEKRGFSSYYVFVIEVKTKGGGRYMIFRRYRQFYNLHTKLEERYGAESKNSRFTCMLPVLPGKVYVGAKREIADSRIPALNIYMKKLLSLPSWVLLDETVRLFFYQSDFDSEQTPQGLRRLRPRTRRVKSMCPQEQSFDRMAAPRAEALFDFMGSTKLELSFKKGDLIYLLSKINKDWFEGTVNDATGIFPCAFVTVIKDLPQEEDSINWLRCYYHEDNVSTIRDISVEEDLSSTPFFKDLMELVRREFGRNDIALNYRDAEGDLIRLLSDEDVVLMVMQGRSWPLEKYIFPWKLHVTQQDDYSVYNLTGSAASTPRAVEP"	"unreviewed"	"{'taxId': '28377', 'scientificName': 'Anolis carolinensis', 'fullName': 'Anolis carolinensis (Green anole)'}"
