"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G0V8J5"	"{'domain_architectures': 4952, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 2, 'pfam': 2, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4952}"	"['Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes']"	"NCAS0A12360"	"[{'identifier': 'GO:0000027', 'name': 'ribosomal large subunit assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"G0V8J5_NAUCA"	"c6aebf5278acac33a60101385747d8081782d964"	True	False	239	"Ribosome assembly factor mrt4"	3	"UP000001640"	"MPRSKRSKLVTLAQTDKKGRENKERIFDEVREGLDTYRYVWVLYLDNVRTPVLQEIRTAWTGSKLIMGKKKVLAKALGEKREEEYKENLFKLASLCTGVTGLLFTNEDVDTVKNYFQSYVKLDFSRPNSRAPLTFVIPEGIVYSRGGQIPIDDDIPMVHSLEPTLRNKFEIPTKIKAGKITLDSPYQVCQEGEKLDVRQALILKQFGVAASEFKVKVAAYYDNETSTVEKTEINIESKD"	"unreviewed"	"{'taxId': '27288', 'scientificName': 'Naumovozyma castellii', 'fullName': 'Naumovozyma castellii (Yeast)'}"