"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G0S4L1"	"{'domain_architectures': 38603, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 38603}"	"['Eukaryotic CPN10 homolog which is essential for mitochondrial protein biogenesis, together with CPN60. Binds to CPN60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter']"	"CTHT_0031390"	"[{'identifier': 'GO:0006457', 'name': 'protein folding', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0044183', 'name': 'protein folding chaperone', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G0S4L1_CHATD"	"96ac8ba8a540be879c6c062e6821e3878208f354"	True	False	False	105	"Putative mitochondrial 10 kDa heat shock protein"	3	"UP000008066"	"MKATAIRNIKSLVPLLDRVLVQRIKAEAKTASGIYLPESSVKELNEARVLAVGPGALDKDGKRVPMGVQAGDRVLIPQYGGTSIKVGEEEYHIFRDSEILAKINE"	"unreviewed"	"{'taxId': '759272', 'scientificName': 'Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)', 'fullName': 'Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)'}"