"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"G0M108"	"{'domain_architectures': 30661, 'entries': 23, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'cdd': 1, 'pfam': 2, 'smart': 2, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'prosite': 1, 'prints': 1, 'interpro': 9}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 30661}"	"['Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity']"	"ftsZ"	"[{'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"G0M108_LACPE"	"cbbeeb35c1609cb87cda9690287a256c6f6af835"	True	False	False	428	"Cell division protein FtsZ"	3	""	"MEFSLDSTQNSGANIKVIGVGGGGGNAVNRMIAEDVKGVEFIVANTDVQALQTSNAETKIQLGPKLTRGLGAGSNPDVGSKAAQESEEALTEALQGADMVFVTAGMGGGTGNGAAPVVAKIAKDSGALTVGVVTRPFTFEGPKRARNAAEGIAQMKDNVDTLIVIANNRLLEIVDKKTPMMEAFQEADNVLRQGVQGISDLITSPGYVNLDFADVKTVMQNQGSALMGIGSATGENRTADATKQAISSPLLEVSIDGAEQVLLNITGGPDMSLYEAQAASDIVSQAATTEVNIIFGTSIDESLGDEVRVTVIATGIDQKQRELKLGNQSTRTAASQQRGGMFSNNSTDQPATSEAAQPSESQADDPFGNWDIRREPNNSRPVNNGQEFNNVEKTDFDVFNDNSQADDSKDDNSGDSLDTPPFFKRRRK"	"unreviewed"	"{'taxId': '1042160', 'scientificName': 'Lactiplantibacillus pentosus IG1', 'fullName': 'Lactiplantibacillus pentosus IG1'}"
