"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F9UST3"	"{'domain_architectures': 81558, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 81558}"	"['Transporter that facilitates the transmembrane diffusion of D/L-lactic acid. Is involved in the cellular racemization of lactate and lactate metabolism. The transported molecule is indeed lactic acid and not the lactate anion, in agreement with the assumption that, with very few exceptions, MIPs (major intrinsic proteins) only facilitate the transport of uncharged solutes. Also facilitates urea and H(2)O(2) diffusion across membranes, but is not permeable to water, glycerol and dihydroxyacetone']"	"larD"	"[{'identifier': 'GO:0015267', 'name': 'channel activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"LARD_LACPL"	"965a68c334854751a8ef4acc75673927e3dcd4cd"	True	False	False	238	"D/L-lactic acid transporter"	2	"UP000000432"	"MVHQLIAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTWGFGISVALFIFGNVCINPAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYADHFKASTDEISPITIRNLFCTAPAVRNLPRNFFVELFDTFIFISGILAISEIKTPGIVPIGVGLLVWAIGMGLGGPTGFAMNLARDMGPRIAHAILPIANKADSDWQYGIIVPGIAPFVGAAIAAWFMHGFFGIN"	"reviewed"	"{'taxId': '220668', 'scientificName': 'Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)', 'fullName': 'Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)'}"
