"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F9T950"	"{'domain_architectures': 28786, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 28786}"	"['The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II UlaABC PTS system is involved in ascorbate transport']"	"VITU9109_24290"	""	"F9T950_9VIBR"	"63916ddc97314a696e2eb523d0b2663c7608f198"	True	False	False	158	"Ascorbate-specific PTS system EIIA component"	4	"UP000003836"	"MGFKQSLIDNNSIKLQASASNWREAITIGTDMLTASGAILPSYHEAIINSVEKLGPYICIAPNLALPHARPEDGVIRTAFALVTLEEPVFFEGEDEPVDVLITLAGSSSDEHMEGLMEVTTVLDDEDSETGVDLNKLRRCRTKTDVFDVIDEALAETA"	"unreviewed"	"{'taxId': '1051646', 'scientificName': 'Vibrio tubiashii ATCC 19109', 'fullName': 'Vibrio tubiashii ATCC 19109'}"