"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F9T2J4"	"{'domain_architectures': 70904, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 70904}"	"['Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed']"	"map"	"[{'identifier': 'GO:0070006', 'name': 'metalloaminopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006508', 'name': 'proteolysis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F9T2J4_9VIBR"	"b3f357c661ba295d4df0c6b55962d5d621766ffe"	True	False	False	260	"Methionine aminopeptidase"	3	"UP000003836"	"MNSNVAIKSESEIELMRTSGKLLAKVFQMLDDCVKPGVSTMDINNRVEDFIVNELQARPASKGQYDYQYVLNTSLNEVVCHGVPKASQILKSTDIINLDITLEKGGFITDSSKMYVMPDANPLARKLVKVTYEAMWQGIKQVKPGARLGDIGHAIQSYVETYGYSIVREYCGHGIGREMHEEPQVLHYGIRDTGLLLKEGMVFTIEPMVNQGTEKTKTKKDGWTVITRDKKLSAQSEHTVLVTSSGYEVLTLREEERLPS"	"unreviewed"	"{'taxId': '1051646', 'scientificName': 'Vibrio tubiashii ATCC 19109', 'fullName': 'Vibrio tubiashii ATCC 19109'}"