"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F9QD28"	"{'domain_architectures': 31007, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'hamap': 1, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 31007}"	"['The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug. The plug probably moves laterally to allow the channel to open. The ring and the pore may move independently']"	"secY"	"[{'identifier': 'GO:0015031', 'name': 'protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F9QD28_9BACT"	"f9938721f5ebf4880c46db3c12966b5aff0b4c61"	True	False	False	473	"Protein translocase subunit SecY"	3	"UP000005055"	"MSFFRRKSNKLFLLLKYIKRNFINFWSTKDITKKVLFTLLLLSIYIIGTTITAPFVKINSSRSINSDSFFDTLNLVGGGGLSRFSIFALGISPFINASLIMMILQSKLFPPIYKLSQSGPHGRKKINIITRGITLVIAIPQAIFLTKSLTAGGISSAFINIVSPTGMNENVIVYFILPMILVGATLFCLFLSEEITNKGIGNGTSLIIFTGIAMRLPIQFQSAFKELSNDFLVSGSLIGLINFSFYVICYFLVILIISIVYNSERHVPIQQVGAGRSKNTKEMGKLPIKLNPGGIMPVIFAMMVISFPTMIANILPKDNYGAWWIKHNLQFTQPFGLSLLVAITFVFSLLMGIQQSRVDKIAEDFAKNSTFIPGVRPGEETQDYLIGVVFRLSLFSAFYLVILASMQHIQVILGILPAQIAFGGTGLMILVSVAIETITQLKARNKTVKLAKAKRVTKANFNSKNVNGDGLLW"	"unreviewed"	"{'taxId': '1034808', 'scientificName': 'Mycoplasmopsis anatis 1340', 'fullName': 'Mycoplasmopsis anatis 1340'}"