"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F8VV56"	"{'domain_architectures': 63859, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 63859}"	"['Functions as a cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli']"	"CD63"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F8VV56_HUMAN"	"2f035c93bc0f873636b5d7b827745b2654062619"	True	False	False	145	"CD63 antigen"	1	"UP000005640"	"MLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM"	"unreviewed"	"{'taxId': '9606', 'scientificName': 'Homo sapiens', 'fullName': 'Homo sapiens (Human)'}"