"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F8U3X3"	"{'domain_architectures': 6126, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 6126}"	"['Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus']"	""	"[{'identifier': 'GO:0019028', 'name': 'viral capsid', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F8U3X3_9ADEN"	"90df2992dcf10c52596bafa5a0db13cafcdc9168"	False	False	True	93	"Hexon protein"	3	""	"EYLSENLVQFITATQSFFNLGEKFRDPFVAPTSGVTTDRSQKLQLRIVPIQVEDNENFYKARFTPNVGDNRIADLGSAFFDIEGFLDRGQSFK"	"unreviewed"	"{'taxId': '120509', 'scientificName': 'Bovine adenovirus 8', 'fullName': 'Bovine adenovirus 8'}"