"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F8SPF3"	"{'domain_architectures': 413, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 413}"	"['Forms a double layer around the helical nucleocapsid, the inner matrix layer binding to the N helix and the outer matrix layer binding to the envelope glycoprotein. Plays a major role in assembly and budding of virion, by recruiting cellular partners of the ESCRT complexes that play a key role in releasing the budding particle from the host membrane. Condensates the ribonucleocapsid core during virus assembly. Inhibits the host mRNA nuclear export thereby inducing the shut off of cellular transcription and preventing the interferon signaling and the establishment of antiviral state in infected cells. This shutoff presumably inhibits interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell. Inhibits host transcription, possibly through interaction with host DNA repair factor IIH/TFIIH GTF2H5 subunit']"	"M"	"[{'identifier': 'GO:0005198', 'name': 'structural molecule activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019031', 'name': 'viral envelope', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F8SPF3_9RHAB"	"280e17b5cfc01de5d6aded8972dcf285b91c2589"	False	False	False	229	"Matrix protein"	3	"UP000151729"	"MSSLKKILGIKGKGKKSKKLGMAPPPYEEETPMEYSPSAPYDKSLFGVEDMDFHDQRQLRYEKFHFSLKMTVRSNKPFRNYDDVAAAVSNWDHMYIGMAGKRPFYKILAFMGSTLLKATPAVLADQGQPEYHAHCEGRAYLPHRLGPTPPMLNVPEHFRRPFNIGLFRGTIDITLVLFDDESVDSAPVIWDHFNASRLSSFREKALLFGLILEKKATGNWVLDSISHFK"	"unreviewed"	"{'taxId': '1046251', 'scientificName': 'Maraba virus', 'fullName': 'Maraba virus'}"
