General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F8DI27",
        "id": "F8DI27_STREP",
        "source_organism": {
            "taxId": "760570",
            "scientificName": "Streptococcus parasanguinis (strain ATCC 15912 / DSM 6778 / CIP 104372 / LMG 14537)",
            "fullName": "Streptococcus parasanguinis (strain ATCC 15912 / DSM 6778 / CIP 104372 / LMG 14537)"
        },
        "name": "Putative pyruvate, phosphate dikinase regulatory protein",
        "description": [
            "Bifunctional serine/threonine kinase and phosphorylase involved in the regulation of the pyruvate, phosphate dikinase (PPDK) by catalyzing its phosphorylation/dephosphorylation"
        ],
        "length": 270,
        "sequence": "MKKEIIVYSISDSLGGTSQKLLSAVSAQYPDIIFNNSYRFPFINQEEELLDILCDAMKDDALVISTLVNSQLSAVAREFSQKQGLSYLDLMHPFFEIIQEKTGTRPIEVPGTLHRLDSDYFKKISAIEFAVKYDDGKAPQGFLEADLVLLGVSRTSKTPLSIFLANKGYKVANLPLIPEVPLPQVLEKVDSRRLIGLVCEPEKLMKIRSHRLGSLGLVQETNYTDLEKIYQELDYSKIIFKKLGAQVINMTDKSIEETAFLIEEQLKKMN",
        "proteome": null,
        "gene": "HMPREF0833_10703",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016772",
                "name": "transferase activity, transferring phosphorus-containing groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "71c87f850675ff51669fe1904cb0d6751d64ac95",
        "counters": {
            "domain_architectures": 13369,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13369
        }
    }
}