"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F7HX78"	"{'domain_architectures': 28922, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'ssf': 2, 'cathgene3d': 2, 'panther': 1, 'hamap': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 28922}"	"['As a component of the mitochondrial large ribosomal subunit, plays a role in mitochondrial translation. When present in mitochondria as a free protein not associated with the ribosome, associates with mitochondrial RNA polymerase POLRMT to activate transcription. Required for POLRMT stability']"	"MRPL12"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F7HX78_CALJA"	"ce7beeadb990845527f31ed1a708bdd60497c441"	True	False	False	198	"Large ribosomal subunit protein bL12m"	2	"UP000008225"	"MLPAAARPLWGPCLGLQATAFRLARQQVPCVCAVRHVRSSSHRRGEALAGAPLDNTPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMPGAVPAAAAQEVVEEEIPKLKEQTHFTVRLTEANPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE"	"unreviewed"	"{'taxId': '9483', 'scientificName': 'Callithrix jacchus', 'fullName': 'Callithrix jacchus (White-tufted-ear marmoset)'}"
