GET /api/protein/UniProt/F7FUH7/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7FUH7",
"id": "F7FUH7_MONDO",
"source_organism": {
"taxId": "13616",
"scientificName": "Monodelphis domestica",
"fullName": "Monodelphis domestica (Gray short-tailed opossum)"
},
"name": "Regulator of G-protein signaling 2",
"description": [
"Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. It is involved in the negative regulation of the angiotensin-activated signaling pathway. Plays a role in the regulation of blood pressure in response to signaling via G protein-coupled receptors and GNAQ. Plays a role in regulating the constriction and relaxation of vascular smooth muscle. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein"
],
"length": 211,
"sequence": "MQSVMFLAFQPNCGSMEKSACGYPKDEEKREKMKRTILKDWKTRLSYFLQNSSTPGKPKANKKGKQQAFIKPSPEEAQLWSETFDELLANKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLNSKARKIYTDFIEKEAPKEINIDFQTKTMIAQNIEEATTGCFITAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITREPQAT",
"proteome": "UP000002280",
"gene": "RGS2",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "3962b823cbd84ba1c9ff3d7eb9ca5befd0245855",
"counters": {
"domain_architectures": 20645,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"profile": 1,
"smart": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 20645
}
}
}