"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F7DGU2"	"{'domain_architectures': 1739, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1739}"	"['Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors']"	"med30"	""	"F7DGU2_XENTR"	"8a87f9583140f5223a20b88d92ee3d45721f3e4d"	True	False	False	184	"Mediator of RNA polymerase II transcription subunit 30"	2	"UP000008143"	"MSTPPLSGPGMGAAAGPGGFPGAQAATAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTVTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLVPYVEEEYSKHDDRGIASQLRFASEEKREILEVNKKLKQKNQQLKQIMDQLRNLIWDINSMLAMRN"	"unreviewed"	"{'taxId': '8364', 'scientificName': 'Xenopus tropicalis', 'fullName': 'Xenopus tropicalis (Western clawed frog)'}"