"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F7CCI7"	"{'domain_architectures': 865, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'smart': 1, 'cdd': 1, 'ssf': 1, 'pfam': 2, 'panther': 1, 'prints': 4, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 865}"	"['Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore']"	"IL1B"	"[{'identifier': 'GO:0005125', 'name': 'cytokine activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006954', 'name': 'inflammatory response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006955', 'name': 'immune response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005615', 'name': 'extracellular space', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005149', 'name': 'interleukin-1 receptor binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"F7CCI7_HORSE"	"eca67f31d16121c20fb6a444eefb266f5c7eeb75"	True	False	False	268	"Multifunctional fusion protein"	3	"UP000002281"	"MAAVPDTSDMMTYCSGNENDLFFEEDGPKQMKGSFQDLDLSSMGDGGIQLQISHHLYNKTFKHAMSIIVAVEKLKKIPVPCSQAFQDDDLRSLFSVIFEEEPIICDNWDEGYVCDAAMHSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGEEETDKIPVALGLKGKNLYLSCGTKDGKPILQLETVDPNTYPKRKMEKRFVFNKMEIKGNVEFESAMYPNWYISTSQAEKKPVFLGNTRGGQDITDFIMEITSA"	"unreviewed"	"{'taxId': '9796', 'scientificName': 'Equus caballus', 'fullName': 'Equus caballus (Horse)'}"