"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F6RA93"	"{'domain_architectures': 5301, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5301}"	"[""Binds directly and specifically 1,2-Diacyl-sn-glycero-3-phospho-(1'-myo-inositol-3',4',5'-bisphosphate) (PIP3) leading to the recruitment of PIP3 to mitochondria and may play a role in the regulation of the platelet activation via AKT/GSK3B/cGMP signaling pathways. May act as transcription factor that regulates SREBP1 (isoform SREBP-1C) expression in order to modulate triglyceride (TG) homeostasis in hepatocytes""]"	"FUNDC2"	""	"F6RA93_HORSE"	"69224364f88145b7fc68cd582d3205020ece1303"	True	False	False	189	"FUN14 domain-containing protein 2"	3	"UP000002281"	"METSAPRAGSQLAATTARHSASYRAEPLRLSSRDELAEMAASAQGNFEGNFDSLDLAEFAKKQPWWRKLFGQESGPSAEKYSVATQLLIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVKSKAEEVVSFVKKNVIVTGGFFGGFLLGMAS"	"unreviewed"	"{'taxId': '9796', 'scientificName': 'Equus caballus', 'fullName': 'Equus caballus (Horse)'}"