"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F6D3M9"	"{'domain_architectures': 3955, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'smart': 1, 'ncbifam': 2, 'hamap': 1, 'pirsf': 1, 'panther': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3955}"	"['Transcription factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Facilitates transcription initiation by enhancing TATA-box recognition by TATA-box-binding protein (Tbp), and transcription factor B (Tfb) and RNA polymerase recruitment. Not absolutely required for transcription in vitro, but particularly important in cases where Tbp or Tfb function is not optimal. It dynamically alters the nucleic acid-binding properties of RNA polymerases by stabilizing the initiation complex and destabilizing elongation complexes. Seems to translocate with the RNA polymerase following initiation and acts by binding to the non template strand of the transcription bubble in elongation complexes']"	"tfe"	"[{'identifier': 'GO:0006367', 'name': 'transcription initiation at RNA polymerase II promoter', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F6D3M9_METPW"	"b306c0cdd3c0b9413e50f5aa0d961fc37579a95f"	True	False	False	185	"Transcription factor E"	3	"UP000009231"	"MLNVNSPMIQDLIRFSQGKGGAEMLADPTVQEILVDITGDEENSVLIIGCMLKGKTTDEEIAEETEIKLNIVRRILYKLYDAGVASYKRSKDPETQWYTYSWKFDEEKVAEIIAKKYEKFSKEIEESLEFEEGNMFFVCLSNGCRYKFEEASENNFICPKCGGSLEYKDNSAVVTELRELKEKIS"	"unreviewed"	"{'taxId': '868131', 'scientificName': 'Methanobacterium paludis (strain DSM 25820 / JCM 18151 / SWAN1)', 'fullName': 'Methanobacterium paludis (strain DSM 25820 / JCM 18151 / SWAN1)'}"
