"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F6BA82"	"{'domain_architectures': 9485, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9485}"	"['CRISPR (clustered regularly interspaced short palindromic repeat), is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). Functions as a ssRNA-specific endoribonuclease. Involved in the integration of spacer DNA into the CRISPR cassette']"	"cas2"	"[{'identifier': 'GO:0004521', 'name': 'RNA endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043571', 'name': 'maintenance of CRISPR repeat elements', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F6BA82_METIK"	"90498c5266653025b24213eb7ec07442f2010c67"	True	False	False	85	"CRISPR-associated endoribonuclease Cas2"	3	"UP000009227"	"MYVVIVYDVNVSRVNKVKKFLRQHLNWVQNSVFEGEITKAEFERIKDGLLNIIDENEDSIIIYKLKSKPSREIYGIEKNPIDDII"	"unreviewed"	"{'taxId': '880724', 'scientificName': 'Methanotorris igneus (strain DSM 5666 / JCM 11834 / Kol 5)', 'fullName': 'Methanotorris igneus (strain DSM 5666 / JCM 11834 / Kol 5)'}"
