"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F4XWS9"	"{'domain_architectures': 1630, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1630}"	"['Participates in efficiency of electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). This plastocyanin-docking protein contributes to the specific association of plastocyanin to PSI']"	"LYNGBM3L_45570"	"[{'identifier': 'GO:0015979', 'name': 'photosynthesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009522', 'name': 'photosystem I', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0009538', 'name': 'photosystem I reaction center', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F4XWS9_9CYAN"	"e4cf84b3d7417afba139e045fd0932c9e4da72ef"	True	False	False	164	"Photosystem I reaction center subunit III"	3	"UP000003959"	"MRRLLALIFAVSVWLCAISPASASLDHLTPCSESAAFQARKAQFLNTTGDPNSGANRFERYSQALCGDEGYPHLIVDGRFSHMGDFLIPSLLFLYITGWIGWAGRSYLQAIQKGKNPEEKEVIIDVPVAFSKMLMAASWPLLAFKEITTGEMFAKDDEIPVSPR"	"unreviewed"	"{'taxId': '489825', 'scientificName': 'Moorena producens 3L', 'fullName': 'Moorena producens 3L'}"