"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F4X8N4"	"{'domain_architectures': 62699, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 62699}"	"['Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation']"	"G5I_14774"	"[{'identifier': 'GO:0008199', 'name': 'ferric iron binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006826', 'name': 'iron ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006879', 'name': 'intracellular iron ion homeostasis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F4X8N4_ACREC"	"cec8b804a2b695828936e90d7cf5ad612fb951b2"	True	False	True	163	"Ferritin"	3	"UP000007755"	"YFIVQAAYFGRVDVALPGCESFFMQMHHEEHEHALRFCNYVKMRGGKVCLYAISLPNDQDWKCPLHAFKTALQLEIDVGKKLVAVNSVAEKHGDLNASDFIITGFMEDQMKSINEFGRLTTILSGVGDQALARFLFDKNLLENYVMSNFNVLKSKSLLRKFDK"	"unreviewed"	"{'taxId': '103372', 'scientificName': 'Acromyrmex echinatior', 'fullName': 'Acromyrmex echinatior (Panamanian leafcutter ant)'}"
