"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F4P7U9"	"{'domain_architectures': 5083, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'pirsf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5083}"	"['Functions as a component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks', 'Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development']"	"BATDEDRAFT_26639"	"[{'identifier': 'GO:0030833', 'name': 'regulation of actin filament polymerization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0034314', 'name': 'Arp2/3 complex-mediated actin nucleation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005885', 'name': 'Arp2/3 protein complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015629', 'name': 'actin cytoskeleton', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F4P7U9_BATDJ"	"0e45d84588e85f9086ccff9a45d337a9812bc30a"	True	False	False	151	"Actin-related protein 2/3 complex subunit 5"	3	"UP000007241"	"MAHRKTDVDFDDEDQYVDDGPADPSVSELDALLSSKTTDVRNLLSRGNVAAALQTALSNPPTGKSKDVDPLKERATQLVVETLATVRPTDIPAVVKELQPAHIDVLMKYLYRGMASPDLFNSALLLSWHEKAYEVGGLGSIVRVLSDGRSV"	"unreviewed"	"{'taxId': '684364', 'scientificName': 'Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211)', 'fullName': 'Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) (Frog chytrid fungus)'}"