"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F4IIA5"	"{'domain_architectures': 29684, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'smart': 1, 'profile': 1, 'pfam': 2, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 29684}"	"['The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity']"	"PAA2"	"[{'identifier': 'GO:0019773', 'name': 'proteasome core complex, alpha-subunit complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0006511', 'name': 'ubiquitin-dependent protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030163', 'name': 'protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005839', 'name': 'proteasome core complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F4IIA5_ARATH"	"b4fc3eb7060592e47b710df6e92c52ef7477efb8"	True	False	False	220	"Proteasome subunit alpha type"	1	"UP000006548"	"MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVWEL"	"unreviewed"	"{'taxId': '3702', 'scientificName': 'Arabidopsis thaliana', 'fullName': 'Arabidopsis thaliana (Mouse-ear cress)'}"