"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F4BV55"	"{'domain_architectures': 50358, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'cdd': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'pirsf': 1, 'pfam': 1, 'prints': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 50358}"	"['Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr)']"	"tyrS"	"[{'identifier': 'GO:0000166', 'name': 'nucleotide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004831', 'name': 'tyrosine-tRNA ligase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006437', 'name': 'tyrosyl-tRNA aminoacylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0004812', 'name': 'aminoacyl-tRNA ligase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006418', 'name': 'tRNA aminoacylation for protein translation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F4BV55_METSG"	"eec45b89b85171af552391185649fe58227bbbee"	True	False	False	319	"Tyrosine--tRNA ligase"	3	"UP000007807"	"MDKLELVMRNTEEIVTVDELKGLLEKPSRPRAYVGYETSGKVHLGHMLTANKLLDLQRAGFDVVVLLADLHAFLNEKGTLEEVRQIADYNRDCFMALGLDPERTEFVYGTDYQLQPDFMLKILQMARNTSLNRARRSMDEVSRNAENPMVSQMIYPLMQAVDIADLKIDLAVGGIDQRKIHMLAREELPRLGLPAPVCLHTPLIPGLNGEKMSSSKGNNIAVDEPAQDVEKKIKSAFCPAKVVENNPVLAICKYHVFPRMEVGMTISRPEKFGGDVHYASYEQLEADFVSGAMHPMDLKKSCAECMIEILAPVREKMKV"	"unreviewed"	"{'taxId': '990316', 'scientificName': 'Methanothrix soehngenii (strain ATCC 5969 / DSM 3671 / JCM 10134 / NBRC 103675 / OCM 69 / GP-6)', 'fullName': 'Methanothrix soehngenii (strain ATCC 5969 / DSM 3671 / JCM 10134 / NBRC 103675 / OCM 69 / GP-6)'}"
