"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F2YKU5"	"{'domain_architectures': 54587, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'profile': 1, 'pirsf': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 54587}"	"[""Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. Involved in different aspects of gene regulation including promoter activation or repression. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. SRY HMG box recognizes DNA by partial intercalation in the minor groove and promotes DNA bending. Also involved in pre-mRNA splicing. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons""]"	"SRY"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0030238', 'name': 'male sex determination', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F2YKU5_PILBA"	"ba71805ac3750d134530e8b8d14e816f9d4dbece"	True	False	True	202	"Sex-determining region Y protein"	3	""	"MQSYASAMLRVFNTDDYSPAAQQNVPALRRSSSFICTESCSSKYQCEAGENSKGSVQDRVKRPMNAFIVWSRDQRRKIALENPKMRNSEISKQLGYQWKMLTEADKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLQNSCSLLPADPSSVLCREMELDNRLYRDDYTKATHSRMQLGHLPPINTASSRQPRDRYSHSTKL"	"unreviewed"	"{'taxId': '164648', 'scientificName': 'Piliocolobus badius', 'fullName': 'Piliocolobus badius (Western red colobus)'}"