"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F2SUV9"	"{'domain_architectures': 4125, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4125}"	"['Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity']"	"TERG_06255"	"[{'identifier': 'GO:0008250', 'name': 'oligosaccharyltransferase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"F2SUV9_TRIRC"	"0b5c0e8a11427f4461e6f428a8ec0d6d1d9af5d9"	True	False	False	156	"Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2"	3	"UP000008864"	"MAPKRREIQSDVTTPPASKVKQQATASSTVPKPSLSTSANAPAKDIILNIWDNYTTNTPQRTLLLDIFMAFLVVVGGTQFVYCVLAGNYPFNAFLSGFSAAVGQFVLTASLRMQTSDVGKTKTAGSSGVSSGADTPIQDRGEGSSERSVFTSIGRM"	"unreviewed"	"{'taxId': '559305', 'scientificName': 'Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)', 'fullName': ""Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892) (Athlete's foot fungus)""}"