"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F2RI05"	"{'domain_architectures': 51627, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 51627}"	"['IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisF subunit catalyzes the cyclization activity that produces IGP and AICAR from PRFAR using the ammonia provided by the HisH subunit']"	"hisF"	"[{'identifier': 'GO:0000107', 'name': 'imidazoleglycerol-phosphate synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000105', 'name': 'L-histidine biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"F2RI05_STRVP"	"3e31a4b4948ec0d53fba3a5c91693bed733c63e9"	True	False	False	251	"Imidazole glycerol phosphate synthase subunit HisF"	3	"UP000006854"	"MSLAVRVIPCLDVDNGRVVKGVNFQNLRDAGDPVEMAKLYDAEGADELTFLDITASSGNRETTYDVVRRTAEQVFIPLTVGGGVRAAEDVDKLLRAGADKVGVNTAAIERPELIQEIAERFGRQVLVLSVDARRTPSGSFEVTTHGGRKGTGIDAVEWAHRAAELGAGEILLNSMDADGTKDGYDTEMIAAVRKHVTVPVIASGGAGKLADFPPAVAAGADAVLAASVFHFGDLRISQVKDELRGAGHPVR"	"unreviewed"	"{'taxId': '953739', 'scientificName': 'Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)', 'fullName': 'Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)'}"
