"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F2KP29"	"{'domain_architectures': 7515, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7515}"	"['Component of the A-type ATP synthase that produces ATP from ADP in the presence of a proton gradient across the membrane']"	"atpF"	"[{'identifier': 'GO:0034220', 'name': 'monoatomic ion transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0046961', 'name': 'proton-transporting ATPase activity, rotational mechanism', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"F2KP29_ARCVS"	"06d4784b2e6318c50671b6dc0edecc495f96d68c"	True	False	False	99	"A-type ATP synthase subunit F"	3	"UP000008136"	"MSRITVVGDPDFNLGFRLVGIRDIIDVDDEEKLPEIVESLLGREGVVVIKYDFYKKLPIQVKMKVEESLEPTFVKVGGEAGVEELRDKIRRAIGVDLWK"	"unreviewed"	"{'taxId': '693661', 'scientificName': 'Archaeoglobus veneficus (strain DSM 11195 / SNP6)', 'fullName': 'Archaeoglobus veneficus (strain DSM 11195 / SNP6)'}"