"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"F2KMN9"	"{'domain_architectures': 1086, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'ssf': 1, 'ncbifam': 1, 'hamap': 1, 'pirsf': 1, 'panther': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1086}"	"[""A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired nicks in opposing strands, leaving a 5'-terminal phosphate and a 3'-terminal hydroxyl group that are subsequently ligated to produce recombinant products""]"	"hjc"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"F2KMN9_ARCVS"	"f309d2b16932c4072297d236e2d8c431b0641c3d"	True	False	False	137	"Crossover junction endodeoxyribonuclease Hjc"	3	"UP000008136"	"MKGKGTRFERELIHRLWENGFAAVRSAGSGAMSYPMPDIVAGNGKKFLAFEVKMRAKLPLYLTEQEVKELVMFSNLFGAESYIAVKIPRSDWVFVSISQLKRTGKGYKIDEDVYAIGSDLDEVLGRSVQLRLEGKDL"	"unreviewed"	"{'taxId': '693661', 'scientificName': 'Archaeoglobus veneficus (strain DSM 11195 / SNP6)', 'fullName': 'Archaeoglobus veneficus (strain DSM 11195 / SNP6)'}"