"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E9ENR1"	"{'domain_architectures': 108117, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'pirsf': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 108117}"	"['PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides']"	"MAA_01763"	"[{'identifier': 'GO:0003755', 'name': 'peptidyl-prolyl cis-trans isomerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000413', 'name': 'protein peptidyl-prolyl isomerization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006457', 'name': 'protein folding', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E9ENR1_METRA"	"ec13550bd3f45711d77ed9b599f14cde4aa876a9"	True	False	False	177	"Peptidyl-prolyl cis-trans isomerase"	3	"UP000002498"	"MSVTLHTSHGDIKIEVFCESVPKTAEARHPLTRRQNFLALCASGYYDGSPFHRLIPKFILQTGAPAHPGPDDPKGGRSIWDAAFEDEIRPSLRHAQRGTVSMANRGPGTNGSQFFVTLDKAPHLDGLNTVFGRVIGDEAMATLARLEAEEVDRKARPLARGDVRIDRVTVHANPLAG"	"unreviewed"	"{'taxId': '655844', 'scientificName': 'Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)', 'fullName': 'Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)'}"
