"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E9ENC5"	"{'domain_architectures': 32952, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32952}"	"['Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates. Mediates the deacylation of G-alpha proteins such as GPA1 in vivo, but has weak or no activity toward palmitoylated Ras proteins. Has weak lysophospholipase activity in vitro; however such activity may not exist in vivo']"	"MAA_01211"	"[{'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"E9ENC5_METRA"	"480047bf4951157f05965ce351dd9692ddf52b46"	True	False	False	329	"Acyl-protein thioesterase 1"	3	"UP000002498"	"MEVPSGPQLLHPSIAEPVSSFAHLMFNLRHAFALSLLLPAIIYLVPLFLKLTSSSARVESAPNGPRGTAKDATFLSSRSASSSDIASDTATMSAASSASSIRRIAPLVIPAAGRHTATVVFIHGLGDTGHGWADAVSFWRTRQSMNEIKFILPHAPHIPITMNGGMPMPGWFDIKTLVKGADEDGPGVLQSRDYLHGLIQQEIKDGIPADRIVLGGFSQGGAMSIFAGLTAPVKIGGIVGLSSWLLLNQKFKDYVPDGNINKDTPIFMGHGDRDPLVLYDLAKDSEKALSSMGYSVTFKTYRGMQHQACAEELGDVEAFLSSRLPPKGH"	"unreviewed"	"{'taxId': '655844', 'scientificName': 'Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)', 'fullName': 'Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)'}"