"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E9E0M5"	"{'domain_architectures': 2662, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'pfam': 2, 'pirsf': 1, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2662}"	"['Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation']"	"NCS6"	"[{'identifier': 'GO:0008033', 'name': 'tRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000049', 'name': 'tRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0002098', 'name': 'tRNA wobble uridine modification', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0034227', 'name': 'tRNA thio-modification', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E9E0M5_METAQ"	"ecea3fd540da2a3be05a58e475a5fac2d5801c14"	True	False	393	"Cytoplasmic tRNA 2-thiolation protein 1"	3	"UP000002499"	"MPPAACLRCGNRAVIKRPKNHHKLCKECFLSAFEDEVHHTITSSKLFYPGEKVAIGASGGKDSTVLASVLKTLNERHNYGLDLVLLSIDEGIKGYRDDSLETVKRNAVQYDMPLKIVGYDELFGWTMDQVVETIGKKGNCTYCGVFRRQALDRGANLLNIKHVVTGHNADDIAETVLMNLLRGDLPRLSRSTSIVTGSASTGIQRSKPLKYAYEKEIVLYAHHKKLDYFSTECIYSPEAFRGTARTLIKSLEKVRPSAILDIVRSGEDMARLTPDKSQDACACDDGEGMGGCGSANGRTSGGELAEMEAALKSKHKPTELETEINSNGTSTDDGSIKLPLRGRRQQKGQRQRPTGPLQTLGACIKCGYMSSQQVCHACTLLETLNKNRPEVSI"	"unreviewed"	"{'taxId': '655827', 'scientificName': 'Metarhizium acridum (strain CQMa 102)', 'fullName': 'Metarhizium acridum (strain CQMa 102)'}"
