"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E7FW27"	"{'domain_architectures': 42768, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 42768}"	"['One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome']"	"rplW"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0019843', 'name': 'rRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"E7FW27_ERYRH"	"118b0ee2cd3e298b8d4868fd2abf4aa4160aa12b"	True	False	False	94	"Large ribosomal subunit protein uL23"	3	"UP000003028"	"MKRNPRDIIVRPIITEKTVAMQQNDNKVTFEVAKGSNKIEIRQAIEEIFNVKVEKINVINVLPRKKRVGRYEGQTKAVRKAIVKLAEGSKIEVL"	"unreviewed"	"{'taxId': '525280', 'scientificName': 'Erysipelothrix rhusiopathiae ATCC 19414', 'fullName': 'Erysipelothrix rhusiopathiae ATCC 19414'}"