General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E7DP96",
        "id": "E7DP96_CORCL",
        "source_organism": {
            "taxId": "59861",
            "scientificName": "Coregonus clupeaformis",
            "fullName": "Coregonus clupeaformis (Lake whitefish)"
        },
        "name": "glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)",
        "description": null,
        "length": 231,
        "sequence": "PANIKWGDAGATYVVESTGVFTTIEKASTHLKGGAKRVVISAPSADAPMFVMGVNHEKYENSLKVVSNASCTTNCLAPLAKVIHDNYHIIEGLMSTVHAVTATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPDLNGKITGMAFRVPTPNVSVVDLTVRLEKAASYEDIKKVVKAAADGPMKGILGYTEHQVVSSDFNGDTRSSIFDAGAGIALNDHFVKLVT",
        "proteome": null,
        "gene": "GAPDH",
        "go_terms": [
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016620",
                "name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "ida_accession": "7a78f3561b6209e9a262d9b646b8f6532a476784",
        "counters": {
            "domain_architectures": 3812,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 1,
                "ssf": 2,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3812
        }
    }
}