HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E7CLN1",
"id": "SCX4_RHOJU",
"source_organism": {
"taxId": "419285",
"scientificName": "Rhopalurus junceus",
"fullName": "Rhopalurus junceus (Caribbean blue scorpion)"
},
"name": "Putative beta-neurotoxin RjAa4",
"description": [
"Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing"
],
"length": 65,
"sequence": "KEGYPMGRDGCKISCVINNNFCKVECQAKWRQSDGYCYFWGLSCYCTNLPDDAQVWDSSTNKCGG",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0006952",
"name": "defense response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008200",
"name": "ion channel inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019871",
"name": "sodium channel inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0090729",
"name": "toxin activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": true,
"in_alphafold": true,
"ida_accession": "91cf9b65efdbf553bdb99b3376bcd79a3f1ef44f",
"counters": {
"domain_architectures": 927,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"pfam": 1,
"profile": 1,
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"prints": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 927
}
}
}