General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E7CLN1",
        "id": "SCX4_RHOJU",
        "source_organism": {
            "taxId": "419285",
            "scientificName": "Rhopalurus junceus",
            "fullName": "Rhopalurus junceus (Caribbean blue scorpion)"
        },
        "name": "Putative beta-neurotoxin RjAa4",
        "description": [
            "Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing"
        ],
        "length": 65,
        "sequence": "KEGYPMGRDGCKISCVINNNFCKVECQAKWRQSDGYCYFWGLSCYCTNLPDDAQVWDSSTNKCGG",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006952",
                "name": "defense response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008200",
                "name": "ion channel inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019871",
                "name": "sodium channel inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0090729",
                "name": "toxin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "ida_accession": "91cf9b65efdbf553bdb99b3376bcd79a3f1ef44f",
        "counters": {
            "domain_architectures": 927,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 1,
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 927
        }
    }
}