"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E7A8X6"	"{'domain_architectures': 37588, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'smart': 1, 'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 37588}"	"['Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate']"	"ndk"	"[{'identifier': 'GO:0004550', 'name': 'nucleoside diphosphate kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006183', 'name': 'GTP biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006228', 'name': 'UTP biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006241', 'name': 'CTP biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E7A8X6_HELFC"	"cac8064c040caff7c196d0f0b27a2c0d5516558b"	True	False	False	132	"Nucleoside diphosphate kinase"	3	"UP000007934"	"MSRTLSIIKPDGVQKRIIGKIITRFEEAGLEVVRIKRLKLTPEQAHDFYAVHKERPFFKDLMAFMTSGEVVVMVLEGENAVEKNRELMGATDPKVAKPGTIRADFADNIDANVVHGSDSAENAQREIAFFFA"	"unreviewed"	"{'taxId': '936155', 'scientificName': 'Helicobacter felis (strain ATCC 49179 / CCUG 28539 / NCTC 12436 / CS1)', 'fullName': 'Helicobacter felis (strain ATCC 49179 / CCUG 28539 / NCTC 12436 / CS1)'}"