"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E6YGV3"	"{'domain_architectures': 1059062, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'smart': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1059062}"	"['Part of the ABC transporter complex HmuTUV involved in hemin import. Responsible for energy coupling to the transport system']"	"hmuV"	"[{'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016887', 'name': 'ATP hydrolysis activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"E6YGV3_BARC7"	"48e3bc51d04b3fd112e2624fb984e1b2e9042b86"	True	False	False	264	"ABC transporter domain-containing protein"	3	"UP000009101"	"MIEAINICIQRGKTYILNHVHLQAKSGALTIIIGPNGSGKSTFIKALSGEIPYNGKMTLNGHDIKKTQANKMAMIRAVLPQSTTLAFPFLVHEVVRLGLSINQVNITEAQLKSLPQKALKRVGLADYGNRYYHQLSGGEQARVQLARVLCQIWDPVYNGVARWLILDEPIANLDIQHQLIVMNIIKNFSHCGGGVLAVLHDLNLAAHYADKMILLKQGKIYCEGDASTVLTTENLRKAYHCSLRVSEIPKKNIPFILPQTASHL"	"unreviewed"	"{'taxId': '696125', 'scientificName': 'Bartonella clarridgeiae (strain CCUG 45776 / CIP 104772 / 73)', 'fullName': 'Bartonella clarridgeiae (strain CCUG 45776 / CIP 104772 / 73)'}"
