"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E6S8X6"	"{'domain_architectures': 136430, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 2, 'panther': 1, 'hamap': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 136430}"	"['Regulates the transcription of the pyrimidine nucleotide (pyr) operon in response to exogenous pyrimidines', 'Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant']"	"pyrR"	""	"E6S8X6_INTC7"	"0f8ac38f062a402c09070bf5cbec330fb03fbefd"	True	False	False	196	"Bifunctional protein PyrR"	3	"UP000008914"	"MTCPDLNTPAPHPTIPEDARDVLSSDDIARALRRIGHEILERNKGAADLVLLGIPSRGVPLAQRLGAAIEAVEGVAVPVGELDVTLHRDDLRRQPTRAAHRSRIPETGIDDKVVVLVDDVLYSGRTIRAALDALSELGRPRAVRLAVLVDRGHRELPIRADHVGKNLPTSRDERVHVRLSELDGLDVVRISGGEGR"	"unreviewed"	"{'taxId': '710696', 'scientificName': 'Intrasporangium calvum (strain ATCC 23552 / DSM 43043 / JCM 3097 / NBRC 12989 / NCIMB 10167 / NRRL B-3866 / 7 KIP)', 'fullName': 'Intrasporangium calvum (strain ATCC 23552 / DSM 43043 / JCM 3097 / NBRC 12989 / NCIMB 10167 / NRRL B-3866 / 7 KIP)'}"