"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E6R7E1"	"{'domain_architectures': 10177, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10177}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"CGB_E5240C"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0045271', 'name': 'respiratory chain complex I', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"E6R7E1_CRYGW"	"d25303ede2d23cc5606a3fd67c28712795a4d380"	True	False	False	144	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit"	3	"UP000007805"	"MVSLARTIKHFRLVGFKEWFRQMTYIGDAKYGRLVGTDQFGNRYFEQLNPKEELPGRHRWIDYSQDDFNASQVPPEWHSWIHHIRKDAPIDDAIMKQSSPPWKAPFVENMTGTRGHFKTYSTTTPKVQAWDPVVKPRGGGEAQA"	"unreviewed"	"{'taxId': '367775', 'scientificName': 'Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071)', 'fullName': 'Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii)'}"
