"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E5RPH1"	"{'domain_architectures': 65712, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'profile': 1, 'cdd': 1, 'cathgene3d': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 65712}"	"['Component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity', 'The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides']"	"PSMB8"	"[{'identifier': 'GO:0030163', 'name': 'protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005839', 'name': 'proteasome core complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0004298', 'name': 'threonine-type endopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"E5RPH1_ORYCL"	"d0cadb4b1c9d733ad28db3ac45300c7c0dc1b432"	True	False	False	273	"Proteasome subunit beta"	3	""	"MALANVCGLKNHSEHFGQMFATRRLIDRPNHYSFGTKIQEFAVPVGEEPIGFLKSCNTEGGARFELHHGTTTMAFKFKHGVIVAVDSRASTGSYVDTCEYNKVIEINPYLLGTMSGSAADCKYWERLLAKECRLYRLRNSHRISVAAASKLLCNMMLGYRGMGLSVGSMICGWDKEGPGIYYVDDNGNRLSGRMFSTGSGRNYAYGVLDSGYKEDMTVEEAYELGRRAIVHATHRDSYSGGVVNMYHIQEDGWIKVCKDDVSELLHHYKKGML"	"unreviewed"	"{'taxId': '126373', 'scientificName': 'Oryzias celebensis', 'fullName': 'Oryzias celebensis (Celebes medaka)'}"
