"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E2X8E2"	"{'domain_architectures': 82564, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 3, 'panther': 1, 'prints': 3, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 82564}"	"['Part of a heterodimeric complex that catalyzes the two-step biosynthesis of 4-amino-4-deoxychorismate (ADC), a precursor of p-aminobenzoate (PABA) and tetrahydrofolate. In the first step, a glutamine amidotransferase (PabA) generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by aminodeoxychorismate synthase (PabB) to produce ADC. PabA converts glutamine into glutamate only in the presence of stoichiometric amounts of PabB']"	"Asd1617_04645"	""	"E2X8E2_SHIDY"	"a79a81cdbd2eef5f5e295147e6f92925489d815d"	True	False	False	187	"Aminodeoxychorismate synthase component 2"	4	""	"MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAGISLDVIRHYAGRLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLANPLTVTRYHSLVVEPDSLPACFEVTAWSETREIMGIRHRQWDLEGVQFHPESILSEQGHQLLANFLHR"	"unreviewed"	"{'taxId': '754093', 'scientificName': 'Shigella dysenteriae 1617', 'fullName': 'Shigella dysenteriae 1617'}"
