"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E2BYV5"	"{'domain_architectures': 70645, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'smart': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 70645}"	"['Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome']"	"EAI_11710"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000387', 'name': 'spliceosomal snRNP assembly', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006396', 'name': 'RNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E2BYV5_HARSA"	"83b18cf71a575d59c0de6840812ffe7912383fc4"	True	False	False	123	"Small nuclear ribonucleoprotein Sm D1"	3	"UP000008237"	"MKLVRFLMKLSHETVTIELKNGTQVNGTITGVDVAMNTHLKTVKMTIKNRDPVQLETLSLRGNNIRYYILPDSLPLETLLIDDTPKAKAKKKEAARGAARGRGRGARGGRGGRGGRGRGRGRR"	"unreviewed"	"{'taxId': '610380', 'scientificName': 'Harpegnathos saltator', 'fullName': ""Harpegnathos saltator (Jerdon's jumping ant)""}"