"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E1V6Y1"	"{'domain_architectures': 24039, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'ssf': 1, 'cathgene3d': 1, 'ncbifam': 2, 'smart': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 24039}"	"['Catalyzes the conversion of 7,8-dihydroneopterin to 6-hydroxymethyl-7,8-dihydropterin']"	"folB"	"[{'identifier': 'GO:0004150', 'name': 'dihydroneopterin aldolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006760', 'name': 'folic acid-containing compound metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E1V6Y1_HALED"	"b92a05b3daf9e1c5651b9474330a42b7578a9918"	True	False	False	121	"7,8-dihydroneopterin aldolase"	3	"UP001322512"	"MDLVLIEALKVDTVIGVYDWERTMTQTLVLDLEMATDIRPAAARDAVDETLDYAAISERIADFGATQRFELVETFAERLAETLRHEYAIPWLRLTLRKPGAVPAAGAVGVRIERGTREETP"	"unreviewed"	"{'taxId': '768066', 'scientificName': 'Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)', 'fullName': 'Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)'}"