"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E1F0W7"	"{'domain_architectures': 26078, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'smart': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26078}"	"[""Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines""]"	"NTH1"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006281', 'name': 'DNA repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006284', 'name': 'base-excision repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003906', 'name': 'DNA-(apurinic or apyrimidinic site) endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019104', 'name': 'DNA N-glycosylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006285', 'name': 'base-excision repair, AP site formation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"E1F0W7_GIAIA"	"101d5cd9986e339cda16b6cf5f3a516003f98a8c"	True	False	False	323	"Endonuclease III homolog"	3	""	"MAPIPDLEDTWEKIEAMRAEYVCPVDVFGAHMLSDTTETPDGRFRFAIGLLLSARNLDRVTAAAMYKLNHMLPVPPDGLDKERLKKLEAEFEENTKGLQKSTKAEAMLKKNFPIDIENLMKLNTWRLTAKNVVDSGLDELGRIIHPVGFCRRKAEYMKNVAQICLDNYGGDIPKDLAGILKLPGFGPKMGHLLVQIVYGQVEGIAVDTHVCRIAQRLRWVEKGMCEPNGKMLNPDDVAKQLVETLPKDKWRDINHLLVGFGQTVCKASFPECNRCLIAGTGRCYHKPETKPEAGAGKPRNRERRAKASRRDAEGQGGITDEDE"	"unreviewed"	"{'taxId': '658858', 'scientificName': 'Giardia intestinalis (strain P15)', 'fullName': 'Giardia intestinalis (strain P15)'}"