"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"E0AG76"	"{'domain_architectures': 31473, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 31473}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I']"	"ND4"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042773', 'name': 'ATP synthesis coupled electron transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"E0AG76_9GOBI"	"225f791f31ddde21c804bc34493b1f3f181d470b"	True	False	True	195	"NADH-ubiquinone oxidoreductase chain 4"	3	""	"MLKILIPTIMLVPTTWLAPAKTIWPTALMHSLIIAFMSLMWLHSSGETGWSSLNHFMALDPLSTPLLVLTCWLLPLMILASQNHTAGEPVNRQRVYISLLTSLQIFLIMAFSATEVILFYIMFEATLVPTLLLITRWGNQAERLNAGTYFLFYTLAGSLPLLVALLLLQNTTGTLSLLTLQYAPALPMLTTGDKI"	"unreviewed"	"{'taxId': '870289', 'scientificName': 'Stiphodon pelewensis', 'fullName': 'Stiphodon pelewensis'}"
