"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D9TNX4"	"{'domain_architectures': 8364, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'pirsf': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 8364}"	"['Involved in the maturation of [NiFe] hydrogenases. Required for nickel insertion into the metal center of the hydrogenase']"	"hypA"	"[{'identifier': 'GO:0016151', 'name': 'nickel cation binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051604', 'name': 'protein maturation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"D9TNX4_THETC"	"eb30097e2f8e3b1d58ac74db9274597641c5af5a"	True	False	False	113	"Hydrogenase maturation factor HypA"	3	"UP000001626"	"MHELSITESIVNMVSDEVKKRNINKVTKINIVLGELTGFEEDSIKFYFDVLSEGTPLYGAILNFKRVKAEFKCRNCGMIYNRENFTFKCPYCGSSGVLIEKGKELYIDSIDVE"	"unreviewed"	"{'taxId': '580327', 'scientificName': 'Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032)', 'fullName': 'Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032)'}"
