"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D9SCH7"	"{'domain_architectures': 26390, 'entries': 22, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'smart': 1, 'pfam': 2, 'hamap': 1, 'pirsf': 1, 'ncbifam': 2, 'panther': 1, 'prosite': 2, 'prints': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 26390}"	"['Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and nucleotide specificity is provided by the beta subunit']"	"sucD"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D9SCH7_GALCS"	"df42c0f55114d0e66044e7b8f2abec5437670277"	True	False	False	294	"Succinate--CoA ligase [ADP-forming] subunit alpha"	3	"UP000001235"	"MSILIDKNTRVMTQGMTGKVGQFHTLGCLGYANGANCFVAGVTPNKGGQNFEGVPIYNSVLEAKQQTGATVSVIYVPPAYAAAAIDEAVEADLDLVICITEGIPVHDMIRTRDKMKGKRTLLIGPNCPGLITPDEIKIGIMPGHIHKKGRIGVVSRSGTLTYEAVGQLSALGLGQSSCVGIGGDPINGMKHLDILRLFNEDPETEAVIMVGEIGGSDEEACARWIKDNMKKPVVGFIAGITAPPGKRMGHAGAIISGGQGGADTKLAVMEECGIHITRNPADMGRVMQKILGRS"	"unreviewed"	"{'taxId': '395494', 'scientificName': 'Gallionella capsiferriformans (strain ES-2)', 'fullName': 'Gallionella capsiferriformans (strain ES-2)'}"
